6uxe/1/1:B/2:B

Sequences

>6uxe-a1-m1-cB (length=85) [Search sequence]

AASSRAQVLALYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKR DLGVIRRQVHIGQLYSTDKLIIENR

>6uxe-a1-m2-cB (length=85) [Search sequence]

AASSRAQVLALYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKR DLGVIRRQVHIGQLYSTDKLIIENR

Structure information

PDB ID	6uxe (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the human mitochondrial desulfurase complex Nfs1-ISCU2(M140I)-ISD11 with E.coli ACP1 at 1.57 A resolution showing flexibility of N terminal end of ISCU2
Assembly ID	1
Resolution	1.57Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	10
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	B	B
UniProt accession	Q9HD34	Q9HD34
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:6uxeB	BioLiP:6uxeB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 6uxe-a1-m1-cB_6uxe-a1-m2-cB.pdb.gz

Full biological assembly Download: 6uxe-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	5wkp/1/1:B/1:F 5wlw/1/1:B/1:F 6w1d/1/1:B/2:B 7rtk/1/1:B/2:B
Other dimers with similar sequences but different poses	5usr/2/1:F/1:D 5usr/1/1:B/1:H