6vbf/1/1:B/2:A

Sequences
>6vbf-a1-m1-cB (length=116) [Search sequence]
KLPKILIVEDDERLARLTQEYLIRNGLEVGVETDGNRAIRRIISEQPDLVVLDVLPGADG
LTVCREVRPHYHQPILLTARTEDDQVLGLEGADDYVAKPVQPRVLLARIRALLRRT
>6vbf-a1-m2-cA (length=116) [Search sequence]
KLPKILIVEDDERLARLTQEYLIRNGLEVGVETDGNRAIRRIISEQPDLVVLDVLPGADG
LTVCREVRPHYHQPILLTARTEDDQVLGLEGADDYVAKPVQPRVLLARIRALLRRT
Structure information
PDB ID 6vbf (database links: RCSB PDB PDBe PDBj PDBsum)
Title 1.85 Angstrom Resolution Crystal Structure of N-terminal Domain of Two-component System Response Regulator from Acinetobacter baumannii
Assembly ID 1
Resolution 1.85Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B A
UniProt accession A0A380UY17 A0A380UY17
Species 470 (Acinetobacter baumannii) 470 (Acinetobacter baumannii)
Function annotation BioLiP:6vbfB BioLiP:6vbfA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6vbf-a1-m1-cB_6vbf-a1-m2-cA.pdb.gz
Full biological assembly
Download: 6vbf-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 6br7/1/1:A/1:B 5e3j/1/1:A/1:B 5hm6/1/1:A/1:B
  • [Back to Home]