6vbf/1/1:B/2:A

Sequences

>6vbf-a1-m1-cB (length=116) [Search sequence]

KLPKILIVEDDERLARLTQEYLIRNGLEVGVETDGNRAIRRIISEQPDLVVLDVLPGADG LTVCREVRPHYHQPILLTARTEDDQVLGLEGADDYVAKPVQPRVLLARIRALLRRT

>6vbf-a1-m2-cA (length=116) [Search sequence]

KLPKILIVEDDERLARLTQEYLIRNGLEVGVETDGNRAIRRIISEQPDLVVLDVLPGADG LTVCREVRPHYHQPILLTARTEDDQVLGLEGADDYVAKPVQPRVLLARIRALLRRT

Structure information

PDB ID	6vbf (database links: RCSB PDB PDBe PDBj PDBsum)
Title	1.85 Angstrom Resolution Crystal Structure of N-terminal Domain of Two-component System Response Regulator from Acinetobacter baumannii
Assembly ID	1
Resolution	1.85Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	12
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	B	A
UniProt accession	A0A380UY17	A0A380UY17
Species	470 (Acinetobacter baumannii)	470 (Acinetobacter baumannii)
Function annotation	BioLiP:6vbfB	BioLiP:6vbfA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 6vbf-a1-m1-cB_6vbf-a1-m2-cA.pdb.gz

Full biological assembly Download: 6vbf-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

6br7/1/1:A/1:B 5e3j/1/1:A/1:B 5hm6/1/1:A/1:B