6vda/1/1:A/2:A

Sequences
>6vda-a1-m1-cA (length=86) [Search sequence]
MKRTELDMYDDIFAVLERFPNVHNPHRVRIRRVGTKYFIEMDIEVDGKMSVKDAHELTVK
IRKEMLKRRDDIEDVTIHVEPLGNVE
>6vda-a1-m2-cA (length=86) [Search sequence]
MKRTELDMYDDIFAVLERFPNVHNPHRVRIRRVGTKYFIEMDIEVDGKMSVKDAHELTVK
IRKEMLKRRDDIEDVTIHVEPLGNVE
Structure information
PDB ID 6vda (database links: RCSB PDB PDBe PDBj PDBsum)
Title Metal-bound C-terminal domain of CzcD transporter from Thermotoga maritima
Assembly ID 1
Resolution 2.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 44
Sequence identity between the two chains 1.0
PubMed citation 32505855
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q9WZX9 Q9WZX9
Species 243274 (Thermotoga maritima MSB8) 243274 (Thermotoga maritima MSB8)
Function annotation BioLiP:6vdaA BioLiP:6vdaA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6vda-a1-m1-cA_6vda-a1-m2-cA.pdb.gz
Full biological assembly
Download: 6vda-assembly1.cif.gz
Similar dimers

[Back to Home]