6ven/1/1:Q/1:P

Sequences
>6ven-a1-m1-cQ (length=29) [Search sequence]
NTNVTPHLLAGMRLIDPLRVLGEYLIEQS
>6ven-a1-m1-cP (length=42) [Search sequence]
SQTRKYLNTNVTPHLLAGMRLIAVQQPEDPLRVLGEYLIEQS
Structure information
PDB ID 6ven (database links: RCSB PDB PDBe PDBj PDBsum)
Title Yeast COMPASS in complex with a ubiquitinated nucleosome
Assembly ID 1
Resolution 3.37Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 41
Sequence identity between the two chains 1.0
PubMed citation 31922488
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID Q P
UniProt accession Q03323 Q03323
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
Function annotation BioLiP:6venP
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6ven-a1-m1-cQ_6ven-a1-m1-cP.pdb.gz
Full biological assembly
Download: 6ven-assembly1.cif.gz

[Back to Home]