6vze/1/1:D/1:B

Sequences

>6vze-a1-m1-cD (length=72) [Search sequence]

DTECHFCKSVINQAWNTSEQAMPQAMHQACLRFWLDRQKCEQFVEQHMPQLLALVPRSQD AHITCQALGVCE

>6vze-a1-m1-cB (length=73) [Search sequence]

SDTECHFCKSVINQAWNTSEQAMPQAMHQACLRFWLDRQKCEQFVEQHMPQLLALVPRSQ DAHITCQALGVCE

Structure information

PDB ID	6vze (database links: RCSB PDB PDBe PDBj PDBsum)
Title	C-terminal domain of mouse surfactant protein B crystallized at low pH
Assembly ID	1
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	105
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	B
UniProt accession	P50405	P50405
Species	10090 (Mus musculus)	10090 (Mus musculus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 6vze-a1-m1-cD_6vze-a1-m1-cB.pdb.gz

Full biological assembly Download: 6vze-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	6vze/1/1:A/1:C 6vze/2/1:F/1:E 6vze/2/1:H/1:G
Other dimers with similar sequences but different poses	6vze/1/1:B/1:C 6vze/1/1:D/1:A 6vze/2/1:E/1:G 6vze/2/1:F/1:H