6w40/1/1:B/1:A

Sequences

>6w40-a1-m1-cB (length=115) [Search sequence]

KHLRDMMEIVIKLFMTGDWDAFHEMADPDVKFQVDVGDKHIHRHGREEVVEELIRLLEHW RVRNIRIHDIKLIGDKLVVEGRWETSYGDKSHDEDVELIVIVVDGKIKKVRIIIR

>6w40-a1-m1-cA (length=120) [Search sequence]

GDEEEKHLRDMMEIVIKLFMTGDWDAFHEMADPDVKFQVDVGDKHIHRHGREEVVEELIR LLEHWRVRNIRIHDIKLIGDKLVVEGRWETSYGDKSHDEDVELIVIVVDGKIKKVRIIIR

Structure information

PDB ID	6w40 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	An enumerative algorithm for de novo design of proteins with diverse pocket structures
Assembly ID	1
Resolution	2.49Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	54
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession
Species	32630 (synthetic construct)	32630 (synthetic construct)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6w40-a1-m1-cB_6w40-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6w40-assembly1.cif.gz