6wg1/1/1:H/1:A

Sequences

>6wg1-a1-m1-cH (length=214) [Search sequence]

EVQLVESGGGLVQPGRSLRLSCTTSGFTFGDYAMSWFRQAPGKGLEWVGFIRSKGFGGTA
EYAAFVKGRFTISRDDSRSIAYLQMTSLKPEDTAVYYCSRVGVVIATAVYWGQGTLVTVS
SASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS
SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP

>6wg1-a1-m1-cA (length=215) [Search sequence]

Structure information

PDB ID	6wg1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Fab399 in complex with NPNA6 peptide from circumsporozoite protein
Assembly ID	1
Resolution	2.086Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	34
Sequence identity between the two chains	1.0
PubMed citation	33594061

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	H	A
UniProt accession
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:6wg1H	BioLiP:6wg1A

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	6wg1-a1-m1-cH_6wg1-a1-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	6wg1-assembly1.cif.gz