6wir/1/1:C/2:C

Sequences
>6wir-a1-m1-cC (length=89) [Search sequence]
SDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLR
REPPHCPNSFRLEKILVSVGCTCVTPIVH
>6wir-a1-m2-cC (length=89) [Search sequence]
SDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLR
REPPHCPNSFRLEKILVSVGCTCVTPIVH
Structure information
PDB ID 6wir (database links: RCSB PDB PDBe PDBj PDBsum)
Title Fab antigen complex
Assembly ID 1
Resolution 2.96Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 98
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID C C
UniProt accession Q16552 Q16552
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6wir-a1-m1-cC_6wir-a1-m2-cC.pdb.gz
Full biological assembly
Download: 6wir-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4qhu/1/1:D/1:C 5hhv/1/1:A/2:A 5hi3/1/1:B/1:A 5hi4/1/1:A/1:B 6wio/1/1:C/2:C 7amg/1/1:A/1:B 7amg/2/1:C/1:D 8b7w/1/1:C/2:C

[Back to Home]