6wix/1/2:B/3:B

Sequences
>6wix-a1-m2-cB (length=120) [Search sequence]
AVFLGFLGAAGSTMGAASNQHLLKLTVWGIKQLQARVLAVERYLEVQQLLGIWGCSGKLI
CCTNVPWNSSWSNKSLDEIWNNMTWLQWDKEINNYTQLIYRLIEESQFQQEINEVELLAL
>6wix-a1-m3-cB (length=120) [Search sequence]
AVFLGFLGAAGSTMGAASNQHLLKLTVWGIKQLQARVLAVERYLEVQQLLGIWGCSGKLI
CCTNVPWNSSWSNKSLDEIWNNMTWLQWDKEINNYTQLIYRLIEESQFQQEINEVELLAL
Structure information
PDB ID 6wix (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of HIV-1 MI369 RnS-DS.SOSIP Prefusion Env Trimer in Complex with Human Antibodies 3H109L and 35O22 at 3.5 Angstrom
Assembly ID 1
Resolution 2.67Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 43
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID B B
UniProt accession O55774 O55774
Species 11676 (Human immunodeficiency virus 1) 11676 (Human immunodeficiency virus 1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6wix-a1-m2-cB_6wix-a1-m3-cB.pdb.gz
Full biological assembly
Download: 6wix-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6wix/1/1:B/2:B 6wix/1/1:B/3:B 7llk/1/1:B/1:F 7llk/1/1:B/1:J 7llk/1/1:F/1:J

[Back to Home]