6wk8/1/1:A/1:B

Sequences
>6wk8-a1-m1-cA (length=104) [Search sequence]
MAWLILIIAGIFEVVWAIALKYSNGFTRLIPSMITLIGMLISFYLLSQATKTLPIGTAYA
IWTGIGALGAVICGIIFFKEPLTALRIVFMILLLTGIIGLKATS
>6wk8-a1-m1-cB (length=104) [Search sequence]
MAWLILIIAGIFEVVWAIALKYSNGFTRLIPSMITLIGMLISFYLLSQATKTLPIGTAYA
IWTGIGALGAVICGIIFFKEPLTALRIVFMILLLTGIIGLKATS
Structure information
PDB ID 6wk8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Gdx-Clo from Small Multidrug Resistance family of transporters in complex with phenylguanidinium
Assembly ID 1
Resolution 2.53Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 121
Sequence identity between the two chains 1.0
PubMed citation 33247110
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession U2EQ00 U2EQ00
Species 1321778 (Clostridiales bacterium oral taxon 876 str. F0540) 1321778 (Clostridiales bacterium oral taxon 876 str. F0540)
Function annotation BioLiP:6wk8A BioLiP:6wk8B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6wk8-a1-m1-cA_6wk8-a1-m1-cB.pdb.gz
Full biological assembly
Download: 6wk8-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6wk5/1/1:A/1:B 6wk9/1/1:A/1:B 6wk9/2/1:E/1:F 7szt/1/1:A/1:B 7szt/2/1:C/1:D

[Back to Home]