6wkp/1/1:A/1:B

Sequences
>6wkp-a1-m1-cA (length=103) [Search sequence]
ASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRAPRWYFYYLGTGPEAGLPYG
ANKDGIIWVATEGALNTPKDHIGTRAIVLQLPQGTTLPKGFYA
>6wkp-a1-m1-cB (length=117) [Search sequence]
NTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRKDLSPRWYFYYLGTG
PEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYA
Structure information
PDB ID 6wkp (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of RNA-binding domain of nucleocapsid phosphoprotein from SARS CoV-2, monoclinic crystal form
Assembly ID 1
Resolution 2.67Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
PubMed citation 38327783
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P0DTC9 P0DTC9
Species 2697049 (Severe acute respiratory syndrome coronavirus 2) 2697049 (Severe acute respiratory syndrome coronavirus 2)
Function annotation BioLiP:6wkpA BioLiP:6wkpB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6wkp-a1-m1-cA_6wkp-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6wkp-assembly1.cif.gz

[Back to Home]