6wpz/2/1:B/2:B

Sequences

>6wpz-a2-m1-cB (length=89) [Search sequence]

STPADRARLLIKKIGPKKVSLHGGDYERWKSVSKGAIRVSTEEIDVLVKIFPNYALWIAS GSIAPEVGQTSPDYDEANLNLGAHHHHHH

>6wpz-a2-m2-cB (length=89) [Search sequence]

STPADRARLLIKKIGPKKVSLHGGDYERWKSVSKGAIRVSTEEIDVLVKIFPNYALWIAS GSIAPEVGQTSPDYDEANLNLGAHHHHHH

Structure information

PDB ID	6wpz (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The structure of Pf4r from a superinfective isolate of the filamentous phage Pf4 of Pseudomonas aeruginosa PA01
Assembly ID	2
Resolution	1.993Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	72
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	B	B
UniProt accession	A0A509JD33	A0A509JD33
Species	287 (Pseudomonas aeruginosa)	287 (Pseudomonas aeruginosa)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6wpz-a2-m1-cB_6wpz-a2-m2-cB.pdb.gz

Full biological assembly Download: 6wpz-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6wnm/1/1:A/3:A 6wnm/2/1:B/2:B 6wpz/1/1:A/3:A