6wxq/1/1:A/1:B

Sequences

>6wxq-a1-m1-cA (length=208) [Search sequence]

MKSYFVTMGFNETFLLRLLNETSAQKEDSLVIVVPSPIVSGTRAAIESLRAQISRLNYPP
PRIYEIEITDFNLALSKILDIILTLPEPIISDLTMGMRMINTLILLGIIVSRKRFTVYVR
DEGGGSRVISFNDNTIRALMRDYSREEMKLLNVLYETKGTGITELAKMLDKSEKTLINKI
AELKKFGILTQRKVELNELGLNVIKLNK

>6wxq-a1-m1-cB (length=212) [Search sequence]

Structure information

PDB ID	6wxq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of CRISPR-associated transcription factor Csa3 complexed with cA4
Assembly ID	1
Resolution	2.05Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	114
Sequence identity between the two chains	1.0
PubMed citation	35038453

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q97Y88	Q97Y88
Species	2287 (Saccharolobus solfataricus)	2287 (Saccharolobus solfataricus)
Function annotation	BioLiP:6wxqA	BioLiP:6wxqB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	6wxq-a1-m1-cA_6wxq-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	6wxq-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2wte/1/1:B/1:A 6w11/1/1:B/1:A