6x6f/3/1:F/1:H

Sequences
>6x6f-a3-m1-cF (length=84) [Search sequence]
ESIQSRARTLIDKAGIDRLVRHGEISHSRWQSVRYKDIRMSTEELEVLQSLFPHYRLWLI
SGEVMPEAGQVSPDFEEASRNLAG
>6x6f-a3-m1-cH (length=84) [Search sequence]
ESIQSRARTLIDKAGIDRLVRHGEISHSRWQSVRYKDIRMSTEELEVLQSLFPHYRLWLI
SGEVMPEAGQVSPDFEEASRNLAG
Structure information
PDB ID 6x6f (database links: RCSB PDB PDBe PDBj PDBsum)
Title The structure of Pf6r from the filamentous phage Pf6 of Pseudomonas aeruginosa PA01
Assembly ID 3
Resolution 1.735Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 67
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F H
UniProt accession
Species 287 (Pseudomonas aeruginosa) 287 (Pseudomonas aeruginosa)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6x6f-a3-m1-cF_6x6f-a3-m1-cH.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6x6f-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6x6f/1/1:A/1:B 6x6f/2/1:C/1:D

[Back to Home]