6xb5/1/1:A/1:B

Sequences

>6xb5-a1-m1-cA (length=240) [Search sequence]

MGRTVLNESNKGLVENFSIPAELHERDGKRFASFGTTVPIHCCTPEQVAEFANKTHHYCD
VFTEQVLAPLDELVYVRIDENTAEKVFINRSKRILLVSSDGVLAQWRSAPTFESSNRFLA
GTPIVNKDGDLVSVVTARKGNHYAVSTFEGEGGYFETSQPWKVLDPPEGAAVYGDRWFPS
REEVRAYTLSLPGAAVSAGSPPAPVLHRGGSGRLVLADARGRQLSHHYLHGVATTDVQYL

>6xb5-a1-m1-cB (length=240) [Search sequence]

Structure information

PDB ID	6xb5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of Trichoplusia ni poxin in post-reactive state with Gp[2'-5']Ap[3']
Assembly ID	1
Resolution	2.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	85
Sequence identity between the two chains	1.0
PubMed citation	33191912

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	A0A7E5VPD6	A0A7E5VPD6
Species	7111 (Trichoplusia ni)	7111 (Trichoplusia ni)
Function annotation	BioLiP:6xb5A	BioLiP:6xb5B

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	6xb5-a1-m1-cA_6xb5-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	6xb5-assembly1.cif.gz