6xfj/2/1:D/1:C

Sequences

>6xfj-a2-m1-cD (length=76) [Search sequence]

SASKNSAISSSIFCEKYKQTKEQALTFFQEHPQYMRSKEDEEQLMTEFKKVLLEPGSKNL SIYQTLLAAHERLQAL

>6xfj-a2-m1-cC (length=77) [Search sequence]

NSASKNSAISSSIFCEKYKQTKEQALTFFQEHPQYMRSKEDEEQLMTEFKKVLLEPGSKN LSIYQTLLAAHERLQAL

Structure information

PDB ID	6xfj (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the type III secretion pilotin InvH
Assembly ID	2
Resolution	1.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	119
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	P0CL43	P0CL43
Species	99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)	99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6xfj-a2-m1-cD_6xfj-a2-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6xfj-assembly2.cif.gz

Similar dimers