6xqi/2/1:C/1:D

Sequences

>6xqi-a2-m1-cC (length=63) [Search sequence]

NEWTLELLEELKSEAVRHFPRIWLHNLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIG CSH

>6xqi-a2-m1-cD (length=64) [Search sequence]

ANEWTLELLEELKSEAVRHFPRIWLHNLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRI GCSH

Structure information

PDB ID	6xqi (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of HIV-1 Vpr in complex with the human nucleotide excision repair protein hHR23A
Assembly ID	2
Resolution	2.34Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	27
Sequence identity between the two chains	1.0
PubMed citation	34824204

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	P12520	P12520
Species	11698 (Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE))	11698 (Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE))
Function annotation	BioLiP:6xqiC	BioLiP:6xqiD

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6xqi-a2-m1-cC_6xqi-a2-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6xqi-assembly2.cif.gz

Similar dimers