6xyd/1/1:A/1:C

Sequences
>6xyd-a1-m1-cA (length=106) [Search sequence]
HMPNLCVSATFNPPVITMLGSALREETVKLLEQRIPTGVSVKFLFYPNPDHWRMELSQHF
DDLHKSAVFLTIIEGLEGEGWNLRASNSIRDSESGKDTTKLFFARR
>6xyd-a1-m1-cC (length=106) [Search sequence]
GSHMPNLCVSATFNPPVITMLGSALREETVKLLEQRIPTGVKFLFYPNPDHWRMELSQHF
DDLHKSAVFLTIIEGLEGEGWNLRASNSIRDSESGKDTTKLFFARR
Structure information
PDB ID 6xyd (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Q4D6Q6, a conserved kinetoplastid-specific protein from Trypanosoma cruzi
Assembly ID 1
Resolution 1.81Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 81
Sequence identity between the two chains 0.981
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession Q4D6Q6 Q4D6Q6
Species 353153 (Trypanosoma cruzi strain CL Brener) 353153 (Trypanosoma cruzi strain CL Brener)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 6xyd-a1-m1-cA_6xyd-a1-m1-cC.pdb.gz
Full biological assembly
Download: 6xyd-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 6xyb/1/1:A/1:C 6xyb/1/1:B/1:A 6xyb/1/1:B/1:D 6xyb/1/1:D/1:C 6xyd/1/1:B/1:C 6xyd/1/1:D/1:A 6xyd/1/1:D/1:B

[Back to Home]