6y5e/1/1:C/1:G

Sequences
>6y5e-a1-m1-cC (length=107) [Search sequence]
RAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAA
RDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLP
>6y5e-a1-m1-cG (length=108) [Search sequence]
RAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAA
RDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK
Structure information
PDB ID 6y5e (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of human cGAS (K394E) bound to the nucleosome (focused refinement of cGAS-NCP subcomplex)
Assembly ID 1
Resolution 3.15Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 10
Sequence identity between the two chains 1.0
PubMed citation 32911482
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C G
UniProt accession Q16777 Q16777
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:6y5eC BioLiP:6y5eG
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6y5e-a1-m1-cC_6y5e-a1-m1-cG.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 6y5e-assembly1.cif.gz

[Back to Home]