6ynz/1/1:i5/1:i4

Sequences

>6ynz-a1-m1-ci5 (length=64) [Search sequence]

TREEEWLDKRTKSQEKVYFDQEDRKAMKRLLEKLNTLEVENILKRYHINYTQALIDELVD WKTG

>6ynz-a1-m1-ci4 (length=68) [Search sequence]

TREEEWLDKRTKSQEKVYFDQEDRKAMKRLLEKLNTAPQNLEVENILKRYHINYTQALID ELVDWKTG

Structure information

PDB ID	6ynz (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Cryo-EM structure of Tetrahymena thermophila mitochondrial ATP synthase - F1Fo composite tetramer model
Assembly ID	1
Resolution	3.1Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	31
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	i5	i4
UniProt accession	I7M7C0	I7M7C0
Species	5911 (Tetrahymena thermophila)	5911 (Tetrahymena thermophila)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6ynz-a1-m1-ci5_6ynz-a1-m1-ci4.pdb.gz

Full biological assembly Download: 6ynz-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6ynx/1/1:i1/1:i2 6yny/1/1:i2/1:i1 6ynz/1/1:i2/1:i1