6ys4/3/1:F/1:E

Sequences

>6ys4-a3-m1-cF (length=100) [Search sequence]

GPSQELTNEKEKALQAQVQYQQQHEQQKKDLEILHQQNIHQLQNRSELEAANKDLTERKY KGDSTIRELKAKLSGVEEELQRTKQEVLSLRRENSTLDVE

>6ys4-a3-m1-cE (length=102) [Search sequence]

GPSQELTNEKEKALQAQVQYQQQHEQQKKDLEILHQQNIHQLQNRSELEAANKDLTERKY KGDSTIRELKAKLSGVEEELQRTKQEVLSLRRENSTLDVECH

Structure information

PDB ID	6ys4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the Homo sapiens SAS-6 coiled-coil domain
Assembly ID	3
Resolution	2.11Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	124
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	E
UniProt accession	Q6UVJ0	Q6UVJ0
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6ys4-a3-m1-cF_6ys4-a3-m1-cE.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6ys4-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6ys4/1/1:B/1:A 6ys4/2/1:D/1:C