6ys8/1/1:F/1:G

Sequences

>6ys8-a1-m1-cF (length=60) [Search sequence]

LLSKKVMNFAYGMGAAVVIVGALFKITHFEIGPLTGTVMLSIGLLTEALIFALSAFEPVE

>6ys8-a1-m1-cG (length=60) [Search sequence]

LLSKKVMNFAYGMGAAVVIVGALFKITHFEIGPLTGTVMLSIGLLTEALIFALSAFEPVE

Structure information

PDB ID	6ys8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of GldLM, the proton-powered motor that drives protein transport and gliding motility
Assembly ID	1
Resolution	3.9Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	39
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	G
UniProt accession	Q5EGM4	Q5EGM4
Species	986 (Flavobacterium johnsoniae)	986 (Flavobacterium johnsoniae)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 6ys8-a1-m1-cF_6ys8-a1-m1-cG.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 6ys8-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6ys8/1/1:C/1:D 6ys8/1/1:C/1:G 6ys8/1/1:D/1:E 6ys8/1/1:E/1:F