--> -->

6yud/6/1:I/1:J

Sequences
>6yud-a6-m1-cI (length=98) [Search sequence]
SMKFAVIDRKNFTLIHFEIEKPIKPEILKEIEIPSVDTRKGVVISGRGPIWLHCFLAHKY
AHTPFVAVYDPRLGAVVVQSHSELREGDVIDVVVEEIL
>6yud-a6-m1-cJ (length=98) [Search sequence]
SMKFAVIDRKNFTLIHFEIEKPIKPEILKEIEIPSVDTRKGVVISGRGPIWLHCFLAHKY
AHTPFVAVYDPRLGAVVVQSHSELREGDVIDVVVEEIL
Structure information
PDB ID 6yud (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of Csx3/Crn3 from Archaeoglobus fulgidus in complex with cyclic tetra-adenylate (cA4)
Assembly ID 6
Resolution 1.84Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 91
Sequence identity between the two chains 1.0
PubMed citation 32597755
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID I J
UniProt accession O28415 O28415
Species 2234 (Archaeoglobus fulgidus) 2234 (Archaeoglobus fulgidus)
Function annotation BioLiP:6yudI BioLiP:6yudJ
 
 
ValueError		Python 3.6.8: /usr/bin/python3
Mon Dec 1 02:58:37 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /www/html/HomodimerDB/pdb.cgi in <module>()
    592 
    593     if '_' in entryid:
=>  594         display_dimer(entryid,viewer)
    595     
    596     print('''</table>
display_dimer = <function display_dimer>, entryid = '6yud-a6-m1-cI_6yud-a6-m1-cJ', viewer = ''
 /www/html/HomodimerDB/pdb.cgi in display_dimer(entryid='6yud-a6-m1-cI_6yud-a6-m1-cJ', viewer='')
    311     stdout,stderr=p.communicate()
    312     chainid_list=stdout.decode().splitlines()
=>  313     if max([len(chainid) for chainid in chainid_list])>1:
    314         jsmolBug=True
    315         
builtin max = <built-in function max>, builtin len = <built-in function len>, chainid = 'J', chainid_list = []

ValueError: max() arg is an empty sequence
      args = ('max() arg is an empty sequence',)
      with_traceback = <built-in method with_traceback of ValueError object>