6zif/1/1:D/1:C

Sequences

>6zif-a1-m1-cD (length=107) [Search sequence]

SKEMQSCVDECLRCYQMCFGMAMTHCLETGGDHVKPKHFRAMISCAEMCRNAAHMMLMKS PQARHICEDCAEACEACAKECDALPDMKDCAAQCRRCAEACRKMAGQ

>6zif-a1-m1-cC (length=108) [Search sequence]

SKEMQSCVDECLRCYQMCFGMAMTHCLETGGDHVKPKHFRAMISCAEMCRNAAHMMLMKS PQARHICEDCAEACEACAKECDALPDMKDCAAQCRRCAEACRKMAGQK

Structure information

PDB ID	6zif (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The structure of a cytosolic copper storage protein from Methylocystis sp. Strain Rockwell (ATCC 49242)
Assembly ID	1
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	48
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession
Species	622637 (Methylocystis sp. ATCC 49242)	622637 (Methylocystis sp. ATCC 49242)
Function annotation	BioLiP:6zifD	BioLiP:6zifC

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 6zif-a1-m1-cD_6zif-a1-m1-cC.pdb.gz

Full biological assembly Download: 6zif-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

6zif/1/1:B/1:D 6zif/1/1:A/1:C 6zif/1/1:D/1:A 6zif/1/1:B/1:C