6zmn/1/1:B/1:A

Sequences
>6zmn-a1-m1-cB (length=119) [Search sequence]
GPAVKRLLGWKQGDEEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSL
DGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRV
>6zmn-a1-m1-cA (length=120) [Search sequence]
PAVKRLLGWKQGDEEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLD
GRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVET
Structure information
PDB ID 6zmn (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the Smad3-Smad5 MH1 domain chimera bound to the GGCGC site
Assembly ID 1
Resolution 2.333Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 72
Sequence identity between the two chains 0.992
PubMed citation 33510867
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P84022 P84022
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:6zmnB BioLiP:6zmnA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 6zmn-a1-m1-cB_6zmn-a1-m1-cA.pdb.gz
Full biological assembly
Download: 6zmn-assembly1.cif.gz

[Back to Home]