7a43/1/1:B/1:A

Sequences

>7a43-a1-m1-cB (length=297) [Search sequence]

DLADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIV
ADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHDRGARVSYRLALD
SPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKL
ASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPV
PMLALWGASGIAQSAATPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFS

>7a43-a1-m1-cA (length=298) [Search sequence]

Structure information

PDB ID	7a43 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Fluoroacetate Dehalogenase measured by serial femtosecond crystallography
Assembly ID	1
Resolution	1.75Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	69
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q6NAM1	Q6NAM1
Species	1076 (Rhodopseudomonas palustris)	1076 (Rhodopseudomonas palustris)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7a43-a1-m1-cB_7a43-a1-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7a43-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3r3u/1/1:B/1:A 3r3u/2/1:D/1:C 3r3v/1/1:B/1:A 3r3w/1/1:B/1:A 3r3x/1/1:B/1:A 3r3y/1/1:B/1:A 3r3z/1/1:B/1:A 3r3z/2/1:D/1:C 3r40/1/1:B/1:A 3r41/1/1:B/1:A 5k3a/1/1:B/1:A 5k3b/1/1:A/1:B 5k3c/1/1:B/1:A 5k3d/1/1:A/1:B 5k3e/1/1:B/1:A 5k3f/1/1:B/1:A 5nyv/1/1:A/1:B 5o2g/1/1:A/1:B 5o2i/1/1:A/1:B 5swn/1/1:A/1:B 5t4t/1/1:B/1:A 6fsx/1/1:A/1:B 6gxd/1/1:A/1:B 6gxf/1/1:A/1:B 6gxh/1/1:A/1:B 6gxl/1/1:A/1:B 6gxt/1/1:B/1:A 6muh/1/1:A/1:B 6muy/1/1:A/1:B 6mzz/1/1:A/1:B 6n00/1/1:A/1:B 6qhp/1/1:A/1:B 6qhq/1/1:A/1:B 6qhs/1/1:A/1:B 6qht/1/1:B/1:A 6qhu/1/1:A/1:B 6qhv/1/1:A/1:B 6qhw/1/1:A/1:B 6qhx/1/1:A/1:B 6qhy/1/1:A/1:B 6qhz/1/1:B/1:A 6qi0/1/1:B/1:A 6qi1/1/1:B/1:A 6qi2/1/1:A/1:B 6qi3/1/1:A/1:B 6qks/1/1:B/1:A 6qkt/1/1:B/1:A 6qku/1/1:A/1:B 6qkw/1/1:B/1:A 7a42/1/1:B/1:A