7agv/4/1:G/1:H

Sequences
>7agv-a4-m1-cG (length=160) [Search sequence]
SGLNIKENDLPGIGKKFEIETRSHEKMTIIIHDDGRREIYRFNDRDPDELLSNISLDDSE
ARQIAAILGGMVYKPQALESIEMAFSDLIIEWFKVEKGAKSIGRTLGELDVRQNYDVTVI
AIIKHNQEKLLNPGADSIIEENDTLVLSGERKHLKKLIHD
>7agv-a4-m1-cH (length=162) [Search sequence]
GLNIKENDLPGIGKKFEIETRSHEKMTIIIHDDGRREIYRFNDRDPDELLSNISLDDSEA
RQIAAILGGMVYKPQALESIEMAFSDLIIEWFKVEKGAKSIGRTLGELDVRQNYDVTVIA
IIKHNQEKLLNPGADSIIEENDTLVLSGERKHLKKLIHDFLS
Structure information
PDB ID 7agv (database links: RCSB PDB PDBe PDBj PDBsum)
Title High-resolution structure of the K+/H+ antiporter subunit KhtT in complex with c-di-AMP
Assembly ID 4
Resolution 1.85Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 197
Sequence identity between the two chains 0.994
PubMed citation 33790011
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID G H
UniProt accession O07535 O07535
Species 224308 (Bacillus subtilis subsp. subtilis str. 168) 224308 (Bacillus subtilis subsp. subtilis str. 168)
Function annotation BioLiP:7agvG BioLiP:7agvH
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7agv-a4-m1-cG_7agv-a4-m1-cH.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7agv-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7agv/1/1:A/1:B 7agv/2/1:C/1:D 7agv/3/1:E/1:F
Other dimers with similar sequences but different poses
  • 7ahm/2/1:C/1:D 7agw/1/1:A/1:B 7agy/1/1:A/1:B 7ahm/1/1:A/1:B 7aht/1/1:B/1:A
    		•

    [Back to Home]