7agx/1/1:1G/1:1H

Sequences
>7agx-a1-m1-c1G (length=73) [Search sequence]
DDLVFAGNKALYLVLILSGWPTIVATIIGLLVGLFLPFGIKLLGVCLCLFLLSGWYGEVL
LSYGRQVIFLALA
>7agx-a1-m1-c1H (length=83) [Search sequence]
DDLVFAGNKALYLVLILSGWPTIVATIIGLLVGLFQTVTQLQEQTLPFGIKLLGVCLCLF
LLSGWYGEVLLSYGRQVIFLALA
Structure information
PDB ID 7agx (database links: RCSB PDB PDBe PDBj PDBsum)
Title Apo-state type 3 secretion system export apparatus complex from Salmonella enterica typhimurium
Assembly ID 1
Resolution 3.6Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 37
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID 1G 1H
UniProt accession P0A1L7 P0A1L7
Species 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7agx-a1-m1-c1G_7agx-a1-m1-c1H.pdb.gz
Full biological assembly
Download: 7agx-assembly1.cif.gz

[Back to Home]