7ahi/1/1:2E/1:2K

Sequences

>7ahi-a1-m1-c2E (length=68) [Search sequence]

TPWSGYLDDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDID AAIIQNFR

>7ahi-a1-m1-c2K (length=77) [Search sequence]

PWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSN TVKVFKDIDAAIIQNFR

Structure information

PDB ID	7ahi (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Substrate-engaged type 3 secretion system needle complex from Salmonella enterica typhimurium - SpaR state 2
Assembly ID	1
Resolution	3.3Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	40
Sequence identity between the two chains	0.985

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	2E	2K
UniProt accession	P41784	P41784
Species	99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)	99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 7ahi-a1-m1-c2E_7ahi-a1-m1-c2K.pdb.gz

Full biological assembly Download: 7ahi-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

7ahi/1/1:2E/1:2P 7ah9/1/1:2E/1:2P