7ahl/1/1:F/1:G

Sequences

>7ahl-a1-m1-cF (length=293) [Search sequence]

ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGT
IAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGF
NGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWG
PYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASK
QQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN

>7ahl-a1-m1-cG (length=293) [Search sequence]

Structure information

PDB ID	7ahl (database links: RCSB PDB PDBe PDBj PDBsum)
Title	ALPHA-HEMOLYSIN FROM STAPHYLOCOCCUS AUREUS
Assembly ID	1
Resolution	1.89Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	198
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	G
UniProt accession	P09616	P09616
Species	1280 (Staphylococcus aureus)	1280 (Staphylococcus aureus)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7ahl-a1-m1-cF_7ahl-a1-m1-cG.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7ahl-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3anz/1/1:A/1:B 3anz/1/1:C/1:B 3anz/1/1:C/1:D 3anz/1/1:D/1:E 3anz/1/1:F/1:E 3anz/1/1:F/1:G 3anz/1/1:G/1:A 3anz/2/1:H/1:I 3anz/2/1:H/1:N 3anz/2/1:I/1:J 3anz/2/1:J/1:K 3anz/2/1:L/1:K 3anz/2/1:L/1:M 3anz/2/1:N/1:M 3anz/3/1:O/1:U 3anz/3/1:P/1:O 3anz/3/1:P/1:Q 3anz/3/1:Q/1:R 3anz/3/1:R/1:S 3anz/3/1:T/1:S 3anz/3/1:T/1:U 3anz/4/1:a/1:b 3anz/4/1:V/1:b 3anz/4/1:W/1:V 3anz/4/1:W/1:X 3anz/4/1:X/1:Y 3anz/4/1:Y/1:Z 3anz/4/1:Z/1:a 3m2l/1/1:A/1:B 3m2l/1/1:A/1:G 3m2l/1/1:B/1:C 3m2l/1/1:C/1:D 3m2l/1/1:D/1:E 3m2l/1/1:E/1:F 3m2l/1/1:F/1:G 3m3r/1/1:A/1:B 3m3r/1/1:A/1:G 3m3r/1/1:B/1:C 3m3r/1/1:C/1:D 3m3r/1/1:D/1:E 3m3r/1/1:E/1:F 3m3r/1/1:F/1:G 3m4d/1/1:A/1:B 3m4d/1/1:A/1:G 3m4d/1/1:B/1:C 3m4d/1/1:C/1:D 3m4d/1/1:D/1:E 3m4d/1/1:E/1:F 3m4d/1/1:F/1:G 3m4e/1/1:A/1:B 3m4e/1/1:A/1:G 3m4e/1/1:B/1:C 3m4e/1/1:C/1:D 3m4e/1/1:D/1:E 3m4e/1/1:E/1:F 3m4e/1/1:F/1:G 4p24/1/1:A/1:G 4p24/1/1:B/1:A 4p24/1/1:B/1:C 4p24/1/1:C/1:D 4p24/1/1:E/1:D 4p24/1/1:F/1:E 4p24/1/1:F/1:G 6u3t/3/1:A/1:B 6u3t/3/1:A/3:B 6u3t/3/2:A/2:B 6u3t/3/2:A/4:B 6u3t/3/3:A/2:B 6u3t/3/3:A/3:B 6u3t/3/4:A/1:B 6u3t/3/4:A/4:B 6u3t/3/5:A/5:B 6u3t/3/5:A/7:B 6u3t/3/6:A/6:B 6u3t/3/6:A/8:B 6u3t/3/7:A/6:B 6u3t/3/7:A/7:B 6u3t/3/8:A/5:B 6u3t/3/8:A/8:B 6u49/1/1:A/1:B 6u49/1/1:A/1:G 6u49/1/1:B/1:C 6u49/1/1:C/1:D 6u49/1/1:D/1:E 6u49/1/1:E/1:F 6u49/1/1:F/1:G 6u4p/1/1:A/1:B 6u4p/1/1:A/1:G 6u4p/1/1:B/1:C 6u4p/1/1:C/1:D 6u4p/1/1:D/1:E 6u4p/1/1:E/1:F 6u4p/1/1:F/1:G 7ahl/1/1:A/1:B 7ahl/1/1:A/1:G 7ahl/1/1:B/1:C 7ahl/1/1:C/1:D 7ahl/1/1:D/1:E 7ahl/1/1:E/1:F

Other dimers with similar sequences but different poses

4idj/2/2:A/6:A 4idj/2/1:A/4:A 4idj/2/3:A/5:A

4idj/2/3:A/6:A 4idj/2/1:A/5:A 4idj/2/2:A/4:A

6u3t/3/3:A/8:B 6u3t/3/1:A/5:B 6u3t/3/2:A/6:B 6u3t/3/4:A/7:B 6u3t/3/5:A/1:B 6u3t/3/6:A/2:B 6u3t/3/7:A/4:B 6u3t/3/8:A/3:B