7ak8/3/1:K/1:L

Sequences
>7ak8-a3-m1-cK (length=37) [Search sequence]
SFNFNDEQYEEFINLLDAPVADDPVIEKLLARKPQWD
>7ak8-a3-m1-cL (length=38) [Search sequence]
GSFNFNDEQYEEFINLLDAPVADDPVIEKLLARKPQWD
Structure information
PDB ID 7ak8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of Salmonella TacT1 toxin bound to TacA1 antitoxin C-terminal peptide
Assembly ID 3
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 10
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID K L
UniProt accession Q8ZL97 Q8ZL97
Species 90371 (Salmonella enterica subsp. enterica serovar Typhimurium) 90371 (Salmonella enterica subsp. enterica serovar Typhimurium)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7ak8-a3-m1-cK_7ak8-a3-m1-cL.pdb.gz
Full biological assembly
Download: 7ak8-assembly3.cif.gz
Similar dimers

[Back to Home]