7arr/1/1:D/1:A

Sequences
>7arr-a1-m1-cD (length=30) [Search sequence]
LSEEEIQRIFGLSSEQIKSLPEEYKKVETG
>7arr-a1-m1-cA (length=32) [Search sequence]
LSEEEIQRIFGLSSEQIKSLPEEYKKVETGYL
Structure information
PDB ID 7arr (database links: RCSB PDB PDBe PDBj PDBsum)
Title The de novo designed hybrid alpha/beta-miniprotein
Assembly ID 1
Resolution 1.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 17
Sequence identity between the two chains 1.0
PubMed citation 34032224
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D A
UniProt accession
Species 32630 (synthetic construct) 32630 (synthetic construct)
Function annotation BioLiP:7arrA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7arr-a1-m1-cD_7arr-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7arr-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7arr/2/1:C/1:B 7ars/1/1:B/1:A

[Back to Home]