7b47/1/1:B/1:C

Sequences
>7b47-a1-m1-cB (length=191) [Search sequence]
VPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTR
VRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSV
VVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVHVCA
CPGRDRRTEEE
>7b47-a1-m1-cC (length=191) [Search sequence]
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGT
RVRAMAIYKQSQHMTEVVRRCPHHERCSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVV
VPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVHVCAC
PGRDRRTEEEN
Structure information
PDB ID 7b47 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural basis of reactivation of oncogenic p53 mutants by a small molecule: methylene quinuclidinone (MQ). Human p53DBD-R273H mutant bound to MQ: R273H-MQ (I)
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 0.99
PubMed citation 34862374
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession P04637 P04637
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:7b47B BioLiP:7b47C
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7b47-a1-m1-cB_7b47-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7b47-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7b47/1/1:D/1:A 7b48/1/1:C/1:B 7b48/1/1:D/1:A 7b4b/1/1:C/1:B 7b4b/1/1:D/1:A 7b4c/1/1:A/1:D 7b4c/1/1:B/1:C
Other dimers with similar sequences but different poses
  • 5xzc/2/1:B/1:C 1aie/1/1:A/3:A 1aie/1/2:A/4:A 1c26/1/1:A/4:A 1c26/1/2:A/3:A
  • 3q01/1/1:A/1:B 1aie/1/1:A/4:A 1aie/1/2:A/3:A 2j0z/1/1:A/1:B 2j0z/1/1:C/1:D 2j10/1/1:A/1:B 2j10/1/1:C/1:D 2j11/1/1:A/1:B 2j11/1/1:C/1:D
  • 5xzc/2/1:B/1:D 1c26/1/1:A/3:A 1c26/1/2:A/4:A 1pes/1/1:A/1:B 1pes/1/1:C/1:D 1pet/1/1:A/1:B 1pet/1/1:C/1:D
  • 1pet/1/1:A/1:D 1pes/1/1:A/1:D 1pes/1/1:B/1:C 1pet/1/1:B/1:C
  • 1tup/1/1:B/1:A 1tsr/1/1:B/1:A
  • 5mcv/1/2:A/2:B 1tsr/1/1:B/1:C 1tup/1/1:B/1:C 3kmd/1/1:A/1:D 3kmd/1/1:B/1:C 3kz8/1/1:A/1:B 3kz8/1/2:A/2:B 3q05/1/1:A/1:C 3q05/1/1:B/1:D 3q06/1/1:A/1:C 3q06/1/1:B/1:D 3ts8/1/1:A/1:C 3ts8/1/1:B/1:D 4hje/1/1:A/1:D 4hje/1/1:B/1:C 4mzr/1/1:A/1:C 4mzr/1/1:B/1:D 5lgy/1/1:A/1:C 5lgy/1/1:D/1:B 5mct/1/1:A/1:B 5mct/1/2:A/2:B 5mcu/1/1:A/1:B 5mcu/1/2:A/2:B 5mcv/1/1:A/1:B 5mcw/1/1:A/1:B 5mcw/1/2:A/2:B 5mf7/1/1:A/1:B 5mf7/1/2:A/2:B 5mg7/1/1:A/1:B 5mg7/1/2:A/2:B 5xzc/2/1:D/1:E 6fj5/1/1:A/1:B 6fj5/1/1:C/1:D 7b49/1/1:A/1:B 7b49/1/2:A/2:B 7b4a/1/1:A/1:B 7b4a/1/2:A/2:B 7eeu/1/1:A/1:B 7eeu/1/1:C/1:D 7eeu/2/1:F/1:E 7eeu/2/1:G/1:H 7xzx/1/1:K/1:N 7xzx/1/1:L/1:M 7xzz/1/1:K/1:N 7xzz/1/1:L/1:M
  • 7b4n/1/1:A/2:A 2ac0/1/1:A/1:B 2ac0/1/1:C/1:D 2ady/1/1:A/1:B 2ady/1/2:A/2:B 2ahi/1/1:A/1:B 2ahi/1/1:C/1:D 2ata/1/1:A/1:B 2ata/1/1:C/1:D 3d0a/1/1:A/1:B 3d0a/2/1:C/1:D 3igk/1/1:A/2:A 3igl/1/1:A/2:A 3kmd/1/1:A/1:B 3kmd/1/1:C/1:D 3kz8/1/1:A/2:B 3kz8/1/1:B/2:A 3q05/1/1:A/1:B 3q05/1/1:C/1:D 3q06/1/1:A/1:B 3q06/1/1:C/1:D 3ts8/1/1:A/1:B 3ts8/1/1:C/1:D 4hje/1/1:A/1:B 4hje/1/1:C/1:D 4ibu/1/1:A/1:B 4ibu/1/1:C/1:D 4ibv/1/1:A/2:A 4ibw/1/1:A/2:A 4mzr/1/1:A/1:B 4mzr/1/1:C/1:D 5bua/1/1:A/2:A 5lgy/1/1:A/1:B 5lgy/1/1:C/1:D 5mct/1/1:A/2:B 5mct/1/1:B/2:A 5mcu/1/1:A/2:B 5mcu/1/1:B/2:A 5mcv/1/1:A/2:B 5mcv/1/1:B/2:A 5mcw/1/1:A/2:B 5mcw/1/1:B/2:A 5mf7/1/1:A/2:B 5mf7/1/1:B/2:A 5mg7/1/1:A/2:B 5mg7/1/1:B/2:A 6fj5/1/1:A/1:D 6fj5/1/1:B/1:C 6znc/1/1:A/2:A 7b46/1/1:B/1:A 7b46/1/1:C/1:D 7b49/1/1:A/2:B 7b49/1/1:B/2:A 7b4a/1/1:A/2:B 7b4a/1/1:B/2:A 7b4d/1/1:A/2:A 7b4e/1/1:A/2:A 7b4f/1/1:A/2:A 7b4g/1/1:A/2:A 7b4h/1/1:A/2:A 7eeu/1/1:A/1:C 7eeu/1/1:B/1:D 7eeu/2/1:E/1:G 7eeu/2/1:F/1:H 7xzx/1/1:K/1:L 7xzx/1/1:M/1:N 7xzz/1/1:K/1:L 7xzz/1/1:M/1:N
  • 7b46/1/1:C/1:B 2ac0/1/1:A/1:D 2ac0/1/1:C/1:B 2ady/1/1:A/2:B 2ady/1/2:A/1:B 2ahi/1/1:C/1:B 2ata/1/1:C/1:B 4ibu/1/1:C/1:B
  • 2j10/1/1:B/1:C 2j0z/1/1:A/1:D 2j0z/1/1:B/1:C 2j10/1/1:A/1:D 2j11/1/1:A/1:D 2j11/1/1:B/1:C
  • 7b4c/1/1:B/1:A 7b47/1/1:A/1:B 7b48/1/1:A/1:B 7b4b/1/1:A/1:B 7ygi/1/1:A/1:B
  • [Back to Home]