7bb3/1/1:B/2:A

Sequences
>7bb3-a1-m1-cB (length=54) [Search sequence]
DDSELRNAFETALHEFKKYHSIEAKGYDETYKKLIMSWYYAGYYTGLAEGLAKS
>7bb3-a1-m2-cA (length=54) [Search sequence]
DDSELRNAFETALHEFKKYHSIEAKGYDETYKKLIMSWYYAGYYTGLAEGLAKS
Structure information
PDB ID 7bb3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of S. pombe YG-box oligomer
Assembly ID 1
Resolution 2.158Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 44
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B A
UniProt accession Q09808 Q09808
Species 284812 (Schizosaccharomyces pombe 972h-) 284812 (Schizosaccharomyces pombe 972h-)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7bb3-a1-m1-cB_7bb3-a1-m2-cA.pdb.gz
Full biological assembly
Download: 7bb3-assembly1.cif.gz

[Back to Home]