7bb3/2/1:A/1:B

Sequences

>7bb3-a2-m1-cA (length=54) [Search sequence]

DDSELRNAFETALHEFKKYHSIEAKGYDETYKKLIMSWYYAGYYTGLAEGLAKS

>7bb3-a2-m1-cB (length=54) [Search sequence]

DDSELRNAFETALHEFKKYHSIEAKGYDETYKKLIMSWYYAGYYTGLAEGLAKS

Structure information

PDB ID	7bb3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of S. pombe YG-box oligomer
Assembly ID	2
Resolution	2.158Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	53
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q09808	Q09808
Species	284812 (Schizosaccharomyces pombe 972h-)	284812 (Schizosaccharomyces pombe 972h-)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 7bb3-a2-m1-cA_7bb3-a2-m1-cB.pdb.gz

Full biological assembly Download: 7bb3-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7bb3/1/1:A/1:B 7bb3/1/2:A/2:B