7bgt/1/1:A/1:B

Sequences

>7bgt-a1-m1-cA (length=108) [Search sequence]

WVQPITAQKPSLTLWLDDKMFTGLINTGADVTIIKLEDWPPNWPITDTLTNLRGIGQSNN PKQSSKYLTWRDKENNSGLIKPFVIPNLPVNLWGRDLLSQMKIMMASP

>7bgt-a1-m1-cB (length=108) [Search sequence]

WVQPITAQKPSLTLWLDDKMFTGLINTGADVTIIKLEDWPPNWPITDTLTNLRGIGQSNN PKQSSKYLTWRDKENNSGLIKPFVIPNLPVNLWGRDLLSQMKIMMASP

Structure information

PDB ID	7bgt (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Mason-Pfizer Monkey Virus Protease mutant C7A/D26N/C106A in complex with peptidomimetic inhibitor
Assembly ID	1
Resolution	1.93Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	138
Sequence identity between the two chains	1.0
PubMed citation	33786913

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P07572	P07572
Species	11855 (Mason-Pfizer monkey virus)	11855 (Mason-Pfizer monkey virus)
Function annotation	BioLiP:7bgtA	BioLiP:7bgtB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7bgt-a1-m1-cA_7bgt-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7bgt-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6s1u/1/1:A/1:B 6s1v/1/1:A/1:B 7bgt/2/1:C/1:D 7bgu/1/1:A/1:B 7bgu/2/1:C/1:D