7bhy/2/1:C/2:C

Sequences
>7bhy-a2-m1-cC (length=55) [Search sequence]
AASEKQQLSIEAARLYYQSDYSQQQIAEQLNISRPTVSRLLQYAKEKGYVQIRVM
>7bhy-a2-m2-cC (length=55) [Search sequence]
AASEKQQLSIEAARLYYQSDYSQQQIAEQLNISRPTVSRLLQYAKEKGYVQIRVM
Structure information
PDB ID 7bhy (database links: RCSB PDB PDBe PDBj PDBsum)
Title DNA-binding domain of DeoR in complex with the DNA operator
Assembly ID 2
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 43
Sequence identity between the two chains 1.0
PubMed citation 34726169
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID C C
UniProt accession P39140 P39140
Species 224308 (Bacillus subtilis subsp. subtilis str. 168) 224308 (Bacillus subtilis subsp. subtilis str. 168)
Function annotation BioLiP:7bhyC BioLiP:7bhyC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7bhy-a2-m1-cC_7bhy-a2-m2-cC.pdb.gz
Full biological assembly
Download: 7bhy-assembly2.cif.gz
Similar dimers

[Back to Home]