7bis/1/1:A/2:A

Sequences
>7bis-a1-m1-cA (length=163) [Search sequence]
TKQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMIDRIVHISDVGGKYGKGELVAELDIN
PDLWFFACHFEGDPVMPGCLGLDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPTA
KKVTYNIHIKRTINLVLAIADGTVSVDGREIYSAEGLRVGLFT
>7bis-a1-m2-cA (length=163) [Search sequence]
TKQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMIDRIVHISDVGGKYGKGELVAELDIN
PDLWFFACHFEGDPVMPGCLGLDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPTA
KKVTYNIHIKRTINLVLAIADGTVSVDGREIYSAEGLRVGLFT
Structure information
PDB ID 7bis (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of 3-hydroxydecanoyl-acyl carrier protein dehydratase (FabA)from Pseudomonas aeruginosa in complex with DDD00082063
Assembly ID 1
Resolution 1.96Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 115
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession O33877 O33877
Species 208964 (Pseudomonas aeruginosa PAO1) 208964 (Pseudomonas aeruginosa PAO1)
Function annotation BioLiP:7bisA BioLiP:7bisA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7bis-a1-m1-cA_7bis-a1-m2-cA.pdb.gz
Full biological assembly
Download: 7bis-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4b0b/1/1:B/1:A 4b0c/1/1:A/1:B 4b0c/2/1:C/1:D 4b0c/3/1:E/2:E 4b0i/1/1:C/1:D 4b0i/2/1:A/1:B 4b0i/3/1:E/2:E 4b0j/10/1:R/1:Q 4b0j/1/1:S/1:T 4b0j/2/1:C/1:D 4b0j/3/1:A/1:B 4b0j/4/1:G/1:H 4b0j/5/1:E/1:F 4b0j/6/1:M/1:N 4b0j/7/1:O/1:P 4b0j/8/1:K/1:L 4b0j/9/1:J/1:I 4b8u/1/1:B/1:A 4b8u/2/1:C/1:D 4b8u/3/1:E/2:E 4cl6/1/1:A/1:B 4cl6/2/1:E/2:E 4cl6/3/1:D/1:C 4fq9/1/1:A/1:B 4fq9/2/1:C/1:D 4fq9/3/1:E/1:F 4fq9/4/1:G/1:H 4fq9/5/1:J/1:I 7bhj/1/1:A/2:A 7bhj/2/1:B/1:C 7bhj/3/1:D/1:E 7bis/2/1:B/1:C 7bis/3/1:E/1:D 7bk9/1/1:A/2:A 7bk9/2/1:C/1:B 7bk9/3/1:D/1:E 7bka/1/1:A/2:A 7bka/2/1:C/1:B 7bka/3/1:D/1:E 8b72/1/1:A/1:B 8b72/2/1:D/1:C 8b72/3/1:E/2:E

[Back to Home]