7bnt/1/1:A/1:B

Sequences
>7bnt-a1-m1-cA (length=71) [Search sequence]
KQKIVIKVPMASDKCRSKAMALVASTGGVDSVALVGDLRDKIEVVGDGIDSIKLVSALRK
KVGHAELLQVS
>7bnt-a1-m1-cB (length=75) [Search sequence]
GPGMKQKIVIKVPMASDKCRSKAMALVASTGGVDSVALVGDLRDKIEVVGDGIDSIKLVS
ALRKKVGHAELLQVS
Structure information
PDB ID 7bnt (database links: RCSB PDB PDBe PDBj PDBsum)
Title Complex of rice blast (Magnaporthe oryzae) effector protein AVR-PikD with a predicted ancestral HMA domain of Pik-1 from Oryza spp.
Assembly ID 1
Resolution 1.32Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 50
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession
Species 32630 (synthetic construct) 32630 (synthetic construct)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7bnt-a1-m1-cA_7bnt-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7bnt-assembly1.cif.gz

[Back to Home]