7bnt/1/1:A/1:B

Sequences

>7bnt-a1-m1-cA (length=71) [Search sequence]

KQKIVIKVPMASDKCRSKAMALVASTGGVDSVALVGDLRDKIEVVGDGIDSIKLVSALRK KVGHAELLQVS

>7bnt-a1-m1-cB (length=75) [Search sequence]

GPGMKQKIVIKVPMASDKCRSKAMALVASTGGVDSVALVGDLRDKIEVVGDGIDSIKLVS ALRKKVGHAELLQVS

Structure information

PDB ID	7bnt (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Complex of rice blast (Magnaporthe oryzae) effector protein AVR-PikD with a predicted ancestral HMA domain of Pik-1 from Oryza spp.
Assembly ID	1
Resolution	1.32Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	50
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession
Species	32630 (synthetic construct)	32630 (synthetic construct)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7bnt-a1-m1-cA_7bnt-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7bnt-assembly1.cif.gz