7bqx/1/5:K/5:G

Sequences
>7bqx-a1-m5-cK (length=68) [Search sequence]
PELMWAPSLRNSLRVSPEALELAEREAERARSERWDRCAQVLKNRLLRVELDGIMRDHLA
RAEEIRQD
>7bqx-a1-m5-cG (length=84) [Search sequence]
DPARLPRDTGPELMWAPSLRNSLRVSPEALELAEREAERARSERWDRCAQVLKNRLLRVE
LDGIMRDHLARAEEIRQDLDAVVA
Structure information
PDB ID 7bqx (database links: RCSB PDB PDBe PDBj PDBsum)
Title Epstein-Barr virus, C5 portal vertex
Assembly ID 1
Resolution 4.2Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 42
Sequence identity between the two chains 1.0
PubMed citation 32620850
Chain information
Chain 1 Chain 2
Model ID 5 5
Chain ID K G
UniProt accession P03233 P03233
Species 10377 (Human herpesvirus 4 strain B95-8) 10377 (Human herpesvirus 4 strain B95-8)
Function annotation BioLiP:7bqxK BioLiP:7bqxG
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7bqx-a1-m5-cK_7bqx-a1-m5-cG.pdb.gz
Full biological assembly
Download: 7bqx-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7bqx/1/1:K/1:G 7bqx/1/2:K/2:G 7bqx/1/3:K/3:G 7bqx/1/4:K/4:G 7br7/1/1:K/1:G

[Back to Home]