7bww/5/1:C/1:D

Sequences

>7bww-a5-m1-cC (length=86) [Search sequence]

PLAQQIKNILSLISQADAAGRMDEVRTLQLNLCQLMVEYFQGSPLAQQIKNIHSFGHQAW AAGRLDEVLTIQENLYQLMKEYFQQS

>7bww-a5-m1-cD (length=88) [Search sequence]

GSPLAQQIKNILSLISQADAAGRMDEVRTLQLNLCQLMVEYFQGSPLAQQIKNIHSFGHQ AWAAGRLDEVLTIQENLYQLMKEYFQQS

Structure information

PDB ID	7bww (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the engineered metallo-Diels-Alderase DA7 W16S
Assembly ID	5
Resolution	1.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	45
Sequence identity between the two chains	1.0
PubMed citation	33526894

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession
Species	32630 (synthetic construct)	32630 (synthetic construct)
Function annotation	BioLiP:7bwwC	BioLiP:7bwwD

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7bww-a5-m1-cC_7bww-a5-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7bww-assembly5.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

7bww/5/1:D/1:A 7bww/5/1:C/1:B