7bze/1/1:A/2:A

Sequences
>7bze-a1-m1-cA (length=108) [Search sequence]
DDKRFNCEAELTLAVIGGKWKMLILWHLGKEGTKRFNELKTLIPDITQKILVNQLRELEQ
DMIVHREVYPVVPPKVEYSLTPHGESLMPILEAMYEWGKGYMELIDID
>7bze-a1-m2-cA (length=108) [Search sequence]
DDKRFNCEAELTLAVIGGKWKMLILWHLGKEGTKRFNELKTLIPDITQKILVNQLRELEQ
DMIVHREVYPVVPPKVEYSLTPHGESLMPILEAMYEWGKGYMELIDID
Structure information
PDB ID 7bze (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of Bacillus subtilis HxlR, K13A mutant
Assembly ID 1
Resolution 1.658Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 107
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P42406 P42406
Species 224308 (Bacillus subtilis subsp. subtilis str. 168) 224308 (Bacillus subtilis subsp. subtilis str. 168)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7bze-a1-m1-cA_7bze-a1-m2-cA.pdb.gz
Full biological assembly
Download: 7bze-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 7bzg/3/1:I/1:J 7bzg/1/1:A/1:B 7bzg/2/1:E/1:F
  • [Back to Home]