7bzg/3/1:I/1:J

Sequences

>7bzg-a3-m1-cI (length=110) [Search sequence]

SRMDDKRFNCEKELTLAVIGGKWKMLILWHLGKEGTKRFNELKTLIPDITQKILVNQLRE LEQDMIVHREVYPVVPPKVEYSLTPHGESLMPILEAMYEWGKGYMELIDI

>7bzg-a3-m1-cJ (length=110) [Search sequence]

SRMDDKRFNCEKELTLAVIGGKWKMLILWHLGKEGTKRFNELKTLIPDITQKILVNQLRE LEQDMIVHREVYPVVPPKVEYSLTPHGESLMPILEAMYEWGKGYMELIDI

Structure information

PDB ID	7bzg (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of Bacillus subtilis HxlR, wild type in complex with formaldehyde and DNA
Assembly ID	3
Resolution	2.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	91
Sequence identity between the two chains	1.0
PubMed citation	33495458

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	I	J
UniProt accession	P42406	P42406
Species	224308 (Bacillus subtilis subsp. subtilis str. 168)	224308 (Bacillus subtilis subsp. subtilis str. 168)
Function annotation	BioLiP:7bzgI	BioLiP:7bzgJ

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7bzg-a3-m1-cI_7bzg-a3-m1-cJ.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7bzg-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	7bzg/1/1:A/1:B 7bzg/2/1:E/1:F
Other dimers with similar sequences but different poses	7bze/1/1:A/2:A 7bzd/1/1:A/2:A