7bzg/3/1:I/1:J

Sequences
>7bzg-a3-m1-cI (length=110) [Search sequence]
SRMDDKRFNCEKELTLAVIGGKWKMLILWHLGKEGTKRFNELKTLIPDITQKILVNQLRE
LEQDMIVHREVYPVVPPKVEYSLTPHGESLMPILEAMYEWGKGYMELIDI
>7bzg-a3-m1-cJ (length=110) [Search sequence]
SRMDDKRFNCEKELTLAVIGGKWKMLILWHLGKEGTKRFNELKTLIPDITQKILVNQLRE
LEQDMIVHREVYPVVPPKVEYSLTPHGESLMPILEAMYEWGKGYMELIDI
Structure information
PDB ID 7bzg (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of Bacillus subtilis HxlR, wild type in complex with formaldehyde and DNA
Assembly ID 3
Resolution 2.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 91
Sequence identity between the two chains 1.0
PubMed citation 33495458
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID I J
UniProt accession P42406 P42406
Species 224308 (Bacillus subtilis subsp. subtilis str. 168) 224308 (Bacillus subtilis subsp. subtilis str. 168)
Function annotation BioLiP:7bzgI BioLiP:7bzgJ
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7bzg-a3-m1-cI_7bzg-a3-m1-cJ.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7bzg-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7bzg/1/1:A/1:B 7bzg/2/1:E/1:F
Other dimers with similar sequences but different poses
  • 7bze/1/1:A/2:A 7bzd/1/1:A/2:A
  • [Back to Home]