7c28/1/1:B/1:A

Sequences

>7c28-a1-m1-cB (length=59) [Search sequence]

LTCVTDITEECAAGQKICFKNWKKMGPKLYDVKRGCTATCPKADDNGCVKCCNTDKCNK

>7c28-a1-m1-cA (length=65) [Search sequence]

LTCVTDKSFGGVITEECAAGQKICFKNWKKMGPKLYDVKRGCTATCPKADDNGCVKCCNT DKCNK

Structure information

PDB ID	7c28 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Unusual quaternary structure of a homodimeric synergistic toxin from mamba snake venom
Assembly ID	1
Resolution	2.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	35
Sequence identity between the two chains	1.0
PubMed citation	33000863

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	P01407	P01407
Species	8619 (Dendroaspis jamesoni kaimosae)	8619 (Dendroaspis jamesoni kaimosae)
Function annotation	BioLiP:7c28B	BioLiP:7c28A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 7c28-a1-m1-cB_7c28-a1-m1-cA.pdb.gz

Full biological assembly Download: 7c28-assembly1.cif.gz