7c31/1/1:A/1:B

Sequences
>7c31-a1-m1-cA (length=47) [Search sequence]
RVCESQSHKFEGACMGDHNCALVCRNEGFSGGKCKGLRRRCFCTKLC
>7c31-a1-m1-cB (length=47) [Search sequence]
RVCESQSHKFEGACMGDHNCALVCRNEGFSGGKCKGLRRRCFCTKLC
Structure information
PDB ID 7c31 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the grapevine defensin VvK1
Assembly ID 1
Resolution 1.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession F6HGI0 F6HGI0
Species 29760 (Vitis vinifera) 29760 (Vitis vinifera)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7c31-a1-m1-cA_7c31-a1-m1-cB.pdb.gz
Full biological assembly
Download: 7c31-assembly1.cif.gz

[Back to Home]