7c53/2/1:D/1:F

Sequences
>7c53-a2-m1-cD (length=89) [Search sequence]
TQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNDQ
INVTFLDLEYEMKKLEEAIKKLEESYIDL
>7c53-a2-m1-cF (length=92) [Search sequence]
TQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNLD
QINVTFLDLEYEMKKLEEAIKKLEESYIDLKE
Structure information
PDB ID 7c53 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of SARS-CoV-2 HR1 motif in complex with pan-CoVs inhibitor EK1
Assembly ID 2
Resolution 2.278Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 100
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D F
UniProt accession P0DTC2 P0DTC2
Species 2697049 (Severe acute respiratory syndrome coronavirus 2) 2697049 (Severe acute respiratory syndrome coronavirus 2)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7c53-a2-m1-cD_7c53-a2-m1-cF.pdb.gz
Full biological assembly
Download: 7c53-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7c53/1/1:A/1:B 7c53/1/1:C/1:A 7c53/1/1:C/1:B 7c53/2/1:D/1:E 7c53/2/1:F/1:E

[Back to Home]