7cg8/1/1:C/1:D

Sequences
>7cg8-a1-m1-cC (length=100) [Search sequence]
SVSPVEIAINPASEITATSAFISGTVTKFEQGSGCNISLLYWEASNPMHVKVASSISKKD
FPADISATIKDLKPHTTYQFKVTVNFYFSSSLQTFKTLAL
>7cg8-a1-m1-cD (length=105) [Search sequence]
SVSPVEIAINPASEITATSAFISGTVTKFEQSKGFYGSGCNISLLYWEASNPMHVKVASS
ISKKDFPADISATIKDLKPHTTYQFKVTVNFYFSSSLQTFKTLAL
Structure information
PDB ID 7cg8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the sensor domain (short construct) of the anti-sigma factor RsgI4 in Pseudobacteroides cellulosolvens
Assembly ID 1
Resolution 1.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 34
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession A0A0L6JMH4 A0A0L6JMH4
Species 398512 (Pseudobacteroides cellulosolvens ATCC 35603 = DSM 2933) 398512 (Pseudobacteroides cellulosolvens ATCC 35603 = DSM 2933)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7cg8-a1-m1-cC_7cg8-a1-m1-cD.pdb.gz
Full biological assembly
Download: 7cg8-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 7cg8/1/1:A/1:D 7cg8/1/1:C/1:B
  • [Back to Home]