7d0e/1/1:A/2:A

Sequences
>7d0e-a1-m1-cA (length=96) [Search sequence]
SRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGSRRPWV
LGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWN
>7d0e-a1-m2-cA (length=96) [Search sequence]
SRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGSRRPWV
LGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWN
Structure information
PDB ID 7d0e (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of FIP200 Claw/p-CCPG1 FIR2
Assembly ID 1
Resolution 1.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 32
Sequence identity between the two chains 1.0
PubMed citation 33692357
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q8TDY2 Q8TDY2
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:7d0eA BioLiP:7d0eA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7d0e-a1-m1-cA_7d0e-a1-m2-cA.pdb.gz
Full biological assembly
Download: 7d0e-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 6gma/2/1:C/1:D 6gma/1/1:A/1:B
  • [Back to Home]