7d2h/1/1:B/1:C

Sequences
>7d2h-a1-m1-cB (length=55) [Search sequence]
SEFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEHLEALVSRHERSLRMT
>7d2h-a1-m1-cC (length=56) [Search sequence]
GSEFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEHLEALVSRHERSLRMT
Structure information
PDB ID 7d2h (database links: RCSB PDB PDBe PDBj PDBsum)
Title Tetrameric coiled-coil structure of liprin-alpha2_H2
Assembly ID 1
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 22
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession O75334 O75334
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7d2h-a1-m1-cB_7d2h-a1-m1-cC.pdb.gz
Full biological assembly
Download: 7d2h-assembly1.cif.gz

[Back to Home]