7d3t/2/1:C/1:D

Sequences
>7d3t-a2-m1-cC (length=59) [Search sequence]
TRMRWTPELHERFVDAVNLLGGSEKATPKGVLKLMKADNLTIYHVKSHLQKYRTARYRP
>7d3t-a2-m1-cD (length=62) [Search sequence]
TRMRWTPELHERFVDAVNLLGGSEKATPKGVLKLMKADNLTIYHVKSHLQKYRTARYRPE
LS
Structure information
PDB ID 7d3t (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of OSPHR2 in complex with DNA
Assembly ID 2
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
PubMed citation 35332155
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession B8B5N8 B8B5N8
Species 39946 (Oryza sativa Indica Group) 39946 (Oryza sativa Indica Group)
Function annotation BioLiP:7d3tC BioLiP:7d3tD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7d3t-a2-m1-cC_7d3t-a2-m1-cD.pdb.gz
Full biological assembly
Download: 7d3t-assembly2.cif.gz
Similar dimers

[Back to Home]